目录

S4PRED Logo

Version GPL-3.0 License


S4PRED

A tool for accurate prediction of a protein’s secondary structure from only its amino acid sequence with no evolutionary information i.e. MSA required.

About

S4PRED is a state-of-the-art single-sequence model meaning it doesn’t use homology/evolutionary information to make predictions, only the primary amino acid sequence. It is also a product of our paper Increasing the accuracy of single sequence prediction methods using a deep semi-supervised learning framework published in Bioinformatics. This repo contains the fully trained inference model built in Pytorch. Its a simple one line command to run it on a FASTA file containing a protein sequence(s).

We also provide the 1.08M example pseudo-labelled training set used for training S4PRED. This has been evaluated against the CB513 test set using a cascade of sequence-searching-based methods and annotation matching, as real structure labels aren’t available. Proper cross-validation when working with large sets of protein sequences is incredibly important, especially when working with powerful parametric models like deep neural networks.

Requirements

  • Python 3.7 or greater
  • Pytorch 1.5.1
  • Biopython 1.78 or greater

The script hasn’t been tested on newer Pytorch builds but it should run without any issues. Likewise, most reasonably contemporary Biopython versions should be sufficient, barring some of the oldest.

Installation with ansible:

First ensure that ansible is installeded on your system, then clone the github repo.

pip install ansible
git clone https://github.com/psipred/s4pred.git
cd s4pred/ansible_installer

Next edit the the config_vars.yml to reflect where you would like s4pread and its underlying data to be installed.

You can now run ansible as per

ansible-playbook -i hosts install.yml

You can edit the hosts file to install s4pred on one or more machines. Ansible installation creates a python virtualenv called s4_env. You activate this with

source [app path]/s4_env/bin/activate

If you’re using a virtualenv to install Torch you may find you need to add the paths to virtualenv versions of cudnn/lib/ and nccl/lib/ to your LD_LIBRARY_PATH

Manual Installation

Clone the directory

git clone https://github.com/psipred/s4pred
cd s4pred

Now we download a tarball of the model weights from our public server and then extract.

wget http://bioinfadmin.cs.ucl.ac.uk/downloads/s4pred/weights.tar.gz
tar -xvzf weights.tar.gz

This leaves you with a weights/ directory containing the five models. Each weight file is 86MB and so all together make up roughly 430MB uncompressed (395M compressed). If you would like to check it, the MD5 of the tarball is e04ad7d10b61551f7e07a86b65bb88dc. If you have python and Pytorch installed you should be ready to go.

Using the PSIPRED Workbench

If you would like to generate predictions with S4PRED for a small number of sequences or, for whatever reason, you are unable to run S4PRED locally, there is now the option to use S4PRED via the PSIPRED Workbench. This gives you the option to run S4PRED, along with a variety of other prediction tools, on your sequence(s) of interest and to be emailed when the predictions have all been made with a pretty display of the results along with download links for the generated predictions.

Usage

The S4PRED model can be used to predict a sequence’s secondary structure with the following:

python run_model.py YOUR_FASTA.fas > YOUR_OUTPUT.ss2

Generic Examples

The results of the prediction are piped to stdout and prediction should take less than a second. Another example:

python run_model.py --device gpu --save-files --outdir /home/the_user/s4pred_preds/ --save-by-idx ./example/multi_seqs.ss2

This produces predictions, using an available GPU, for the three sequences in the example FASTA file provided in ./example/multi_seqs.fas. These are saved as s4_out_0.ss2, s4_out_1.ss2, and s4_out_2.ss2 in the directory /home/the_user/s4pred_preds/.

If you wish to simply output an ss2 file for each sequence based on the sequences name (and not ID, as per Biopython’s interpretation):

python run_model.py --save-files --outdir /full/path/to/wanted/save/loc/   /path/to/your/fasta/file.fas

See below for further details regarding the different flags and options that can be set.

Input Sequence File

The expected input is a FASTA formatted file with one or more sequences in it, YOUR_FASTA.fas in the example above. S4PRED will produce seperate predictions for each sequence contained in the FASTA file. See the different options below for how predictions are saved en masse. This is different from the first version of S4PRED (v1.0.0) which operated on files containing a single sequence.

Optional Inputs

There are several optional arguments you can give. Running python run_model.py -h from a terminal will print out all options with short descriptions. More explanation is included below:

  • -d, --device

    • This can be either cpu or gpu. This specifies if you want to run the model on the GPU or the CPU. By default it uses the CPU and in the vast majority of cases this will be sufficient. Also, the model should use less than 1GB of system memory.
  • -t, --outfmt

    • This can be either ss2 or fas or horiz. See the next section for exact details regarding output formats.
  • -c, --fas-conf

    • Including this flag has S4PRED output the 3-class confidence scores (i.e. those output in the .ss2 format) as three additional lines if using .fas output. As the second line is the sequence, and the third line is the class assignment, the fourth through sixth lines are the loop, helix, and strand probabilities respectively.
  • -s, --silent

    • Flag to suppress printing predictions to stdout.
  • -z, --save-files

    • Flag to save each input sequence prediction in an individual file. Makes and saves to a directory called preds/ in the same dir as this script unless –outdir is specified. Note: without the --save-by-idx described below, the files are saved using the name record that Biopython extracts from the header line of the FASTA file. It is common for this to produce somewhat messy file names (TO DO: add name and ID post processing).
  • -o, --outdir p

    • Absolute file-path p, where files are to be saved. If –save-files is used. If not specified, it defaults to making a new directory in the S4PRED directory called preds/ and then saves sequence predictions in that dir.
  • -x, --save-by-idx

    • If saving with –save-files, use a counter to name files instead of sequence ID. This uses the default file name prefix of s4_out_ meaning the files are saved as s4_out_0.ss2 or s4_out_0.fas for the first sequence in a FASTA file.
  • -t2,--outfmt2

    • Save output with a 2nd format, where the first is provided by -t, Either: ss2, fas, or horiz (default; None). The default of None leads to no second file format being saved unless it is explicitly provided.
  • -p,--prefix

    • Use the supplied prefix for output filenames, rather than stdout (default; None), overriding any of the naming decided by the relevant above options.

Output Formats

Of the output file formats, ss2 is the default and it corresponds to the PSIPRED vertical format (PSIPRED VFORMAT). Here is an example of what it looks like:

# PSIPRED VFORMAT (S4PRED V1.0)

   1 M C   0.997  0.000  0.002
   2 G C   0.984  0.000  0.016
   3 D C   0.812  0.001  0.187
   ...

A full example output of this file is located in examples/1qys.ss2.

The alternative fas output returns the sequence FASTA file with the predicted secondary structure concatenated on a second line. Here is an example:

>1QYS_1|Chain A|TOP7|Computationally Designed Sequence
MGDIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL
CCCEEEEEEECCCCCEEEEEEEECCHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCHHHHHHHHHHHHHHHHHCCCCEEEEEEECCEEEEEEEC

The above example output of this file is located in examples/1qys_ss.fas. This is similar to the format of the FASTA flat-file that the RCSB PDB used to provide for all sequences with their DSSP based secondary structure (Downloaded from here). It looks like it was discontinued with the old API, but that is speculation.

The horiz option outputs the results in the PSIPRED horizontal format (PSIPRED HFORMAT). We maintain this output parity with PSIPRED not only for continuity’s sake but also as the HFORMAT is leveraged by the PSIPRED Workbench for graphics, where S4PRED will hopfully soon be added as an option. There is an example of the format included in examples/1qys.horiz.

Example Run

The following is an example run on the sequence of TOP7 (PDB ID: 1QYS) using the GPU and output to the FASTA like format. The corresponding FASTA input file is located in examples/1qys.fas (this is the PDB FASTA file stripped of the 6-HIS tag on the C-Terminus).

python run_model.py --device gpu --outfmt fas ./example/1qys.fas > 1qys_ss.fas

Dataset

We have made the pseudo-labelled training set available to download from our public server. These are in a simple FASTA flat file, s4pred_train.fas.

wget http://bioinfadmin.cs.ucl.ac.uk/downloads/s4pred/s4pred_train.fas

There are 1080886 examples in the set and the contents of the flat file look like this:

>A0A1J5K7I4
MYVCVCNGITEEMLDTAQKQGLSDREILNRLGVGNSCGVCVIDALDNMRSNSLKSQKTSNRKDSKKS
CEEEECCCCCHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCC
>A0A2S4ZHT0
MRPDLMGPGFVQVLARTTLVSRHRPRQQLPSGTVRHAMVQVTERFFSHGPHRPAPGFTPMVRQRYCCA
CCCCCCCCCHHHHHEECEECCCCCCHHCCCCHHHHHEEEEEEHHHHHCCCCCCCCCCCHHHCCCCCCC
>A0A076ETI5
MGALSPSHWAIIAVVLVVLFGSKKLPDAARGLGRSMRILKTEVGELQADAPELEK
CCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHCC
...

The examples go label, then sequence on a new line, and then the 3 class predicted secondary structure on a new line. This doesn’t adhere to the old 80 char line limit of FASTA files so it’s easier to parse. If you’d like a quick parser script raise an issue or submit a pull request. The label is the Uniprot ID of the representative sequence of the Uniclust30 cluster that the example came from.

Importantly, this training set has had several different filters applied (see our paper) to remove homology from the CB513 test set. This makes the dataset ideal for training not just secondary structure predictors but also unsupervised sequence models. In both cases, using this training set with CB513 as a test set provides a strong test of generalization.

Real-Labelled Data

The real-labelled training, validation, and test sets are also available for download as s4pred_cath_train.fas, s4pred_cath_val.fas, and s4pred_cb513_test.fas respectively. These use the same flat file format as s4pred_train.fas.

wget http://bioinfadmin.cs.ucl.ac.uk/downloads/s4pred/s4pred_cath_train.fas
wget http://bioinfadmin.cs.ucl.ac.uk/downloads/s4pred/s4pred_cath_val.fas
wget http://bioinfadmin.cs.ucl.ac.uk/downloads/s4pred/s4pred_cb513_test.fas

Inference Code

If you’d like to train your own version of S4PRED using the AWD-GRU model we used we recommend building off the offical Salesforce AWD-LSTM (https://github.com/salesforce/awd-lstm-lm/) of which our model is a variant. The inference code used in this repo has been pared back to be clean and minimalist. As such, most of the things, like DropConnect, that make the AWD-LSTM what it is, are not present.

Batched Sequence Prediction

The current inference script produces predictions for sequences in batches of 1 for end-user clarity and is very fast regardless. That said, if you would like to run S4PRED on millions or billions of sequences there are obivously large benefits to be had from predicting in batches of several hundred sequences and higher. If this is of interest, please don’t hesitate to raise an issue or get in touch.

Citation

If you use S4PRED in your work please cite the following link to the published article in Bioinformatics:

Increasing the Accuracy of Single Sequence Prediction Methods Using a Deep Semi-Supervised Learning Framework
Lewis Moffat and David T. Jones; Bioinformatics, 07-2021, DOI:10.1093/bioinformatics/btab491 LINK

Here is the corresponding BibTex:

@article{10.1093/bioinformatics/btab491,
    author = {Moffat, Lewis and Jones, David T},
    title = "{Increasing the Accuracy of Single Sequence Prediction Methods Using a Deep Semi-Supervised Learning Framework}",
    journal = {Bioinformatics},
    year = {2021},
    month = {07},
    issn = {1367-4803},
    doi = {10.1093/bioinformatics/btab491},
    url = {https://doi.org/10.1093/bioinformatics/btab491},
}

Changelog

For a log of recent changes please see the changelog in CHANGELOG.md. This is currently being updated manually by @limitloss.

Contact

Current dev & maintainer is @limitloss.

Please don’t hesitate to reach out, either via:

    Gitlink(确实开源)
  • 加入我们
  • 官网邮箱:gitlink@ccf.org.cn
  • QQ群
  • QQ群
  • 公众号
  • 公众号

版权所有:中国计算机学会技术支持:开源发展技术委员会
京ICP备13000930号-9 京公网安备 11010802032778号